PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC014751.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 158aa    MW: 18069.8 Da    PI: 4.9839
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC014751.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.32.9e-3297150255
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   prlrWtp+LH +Fv+ave+LGG+e+AtPk++l+ m+vkgL+++hvkSHLQ+YR+
  EcC014751.10  97 PRLRWTPQLHYSFVQAVERLGGQERATPKSVLQQMNVKGLSINHVKSHLQMYRS 150
                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-3093151IPR009057Homeodomain-like
PROSITE profilePS5129411.7493153IPR017930Myb domain
SuperFamilySSF466891.0E-1595151IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-2497152IPR006447Myb domain, plants
PfamPF002493.7E-1098149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MRETMRSLES TEDHQEKSEE KGEKSSPAVS SQKLSSFDLN EEATFDEHDS PAEDDDLISD  60
EDDNSSIREA EDKPGNRNAE SSETMKAARQ YVRSKMPRLR WTPQLHYSFV QAVERLGGQE  120
RATPKSVLQQ MNVKGLSINH VKSHLQMYRS RKLDEVGQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010057109.19e-98PREDICTED: uncharacterized protein LOC104445014
TrEMBLA0A059C6L85e-89A0A059C6L8_EUCGR; Uncharacterized protein
STRINGGLYMA08G12320.26e-45(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.16e-36G2-like family protein